Analytical Data
-
Gene name
LYZL2
- Application
-
Alternative Names
LYZL2Lysozyme-like protein 2; Lysozyme-2; EC 3.2.1.17
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z4W2
-
Expression Region
1-194aa
-
AA Sequence
MQDAPLSCLSPTKWSSVSSADSTEKSASAAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALVTDDLTDAIICAKKIVKETQGMNYWQGWKKHCEGRDLSDWKKDCEVS
-
Molecular Weight
48 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LYZL2, or Lysozyme-like protein 2, is an intriguing protein that has garnered increasing attention in the scientific community due to its potential roles in immune responses and reproductive health. Originally identified as a member of the lysozyme superfamily, LYZL2 is expressed in various tissues, with significant levels found in the male reproductive system, particularly in the testis and spermatozoa. This expression pattern suggests that LYZL2 may be involved in spermatogenesis and the maturation of sperm, potentially impacting male fertility. Additionally, research has indicated a possible involvement of LYZL2 in antimicrobial defense mechanisms, similar to other lysozymes, reinforcing its importance in protecting against infections. Despite these insights, the precise biological functions and mechanisms of LYZL2 remain poorly understood. Recent studies have aimed to elucidate its structure, functionality, and interactions with other cellular components, which could enhance our understanding of its role in reproduction and immunity. As reproductive health and male infertility are critical issues affecting many individuals, investigating LYZL2 not only sheds light on basic biological processes but may also lead to the development of novel therapeutic strategies for infertility and related disorders. Overall, LYZL2 represents a promising subject of research within the fields of reproductive biology and immunology, with potential implications for both basic science and clinical applications.
