Cat: IPD-X12543

Recombinant Mouse EPHA10 Protein(HEK293), C-His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EPHA10

  • 简介

    EphA10, a receptor for ephrin-A family members, selectively binds EFNA3, EFNA4, and EFNA5, indicating its involvement in mediating cellular responses to ephrin-A ligands and participating in diverse cellular processes regulated by Eph-ephrin signaling pathways. EphA10 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EphA10 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. When Mouse Ephrin-A3 is coated at 5 μg/mL (100 μL/well) can bind Mouse EPHA10. The ED50 for this effect is 0.1148 μg/mL. Measured by its binding ability in a functional ELISA. When Mouse Ephrin-A3 is coated at 5 μg/mL (100 μL/well) can bind Mouse EPHA10. The ED50 for this effect is 0.1148 μg/mL.

  • Alternative Names

    EphA10; FLJ16103; FLJ33655; MGC43817

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    Q8BYG9-1

  • Expression Region

    L23-A565

  • AA Sequence

    LLLGPGRPGTAEEVILLDSKASQAELGWTALPSTGWEEISGVDEHDRPIRTYQVCNVLEPNQDNWLQTGWISRGRGQRIFVELQFTLRDCSSIPGATGTCKETFNAYYLETETDLGRGRPRLGGNRPRKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSRQGFHLAFQDVGACVALVSVRVYYKQCRATVRGLAAFPATAAESAFSTLVEVAGTCVAHSEGEPSSPPRMHCGADGEWLVPVGRCSCSAGFQEHGDICEACPPGFYKVSPRRPLCSPCPEHSLALENASTFCVCQDTYARSPTDPPSASCTRPPSAPRDLQYSLSRSPLALRLRWLPPADSGGRSDVTYSLLCLRCGRDGPAGACQPCGPRVAFVPRQAGLRERAATLLHLRPGARYTVRVAALNGVSGPAAAAGATYAQVTVSTGPGAPWEEDEIRRDRVEPQSVSLSWREPVPAGAPGTNSTEYEIRYYEKGQSEQTYSTVKTGAPAVTVTNLKPATRYVFQIRAASPGPLWEAQSFSPSIEVQTPGEVAPGSRDQSPA

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    60-80 kDa,.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

EPHA10 is a member of the Eph receptor tyrosine kinases, which play significant roles in various biological processes, including cell adhesion, migration, and differentiation. These receptors are crucial for the development of the nervous system and the formation of blood vessels. Due to their involvement in tumorigenesis and metastasis, EPHA10 has garnered attention as a potential target for cancer therapy. Research has shown that aberrations in EPHA10 expression are associated with various cancers, including breast, prostate, and colorectal cancers. Furthermore, studies indicate that EPHA10 can modulate tumor growth and invasion, making it a promising candidate for therapeutic intervention. The generation of recombinant EPHA10 protein is essential for understanding its structure-function relationship, enabling researchers to investigate its signaling pathways and interaction with ligands in detail. Additionally, recombinant EPHA10 can be utilized in drug screening assays and as a basis for developing novel therapeutic agents. Given the urgent need for targeted cancer therapies, ongoing studies aim to elucidate the precise mechanisms by which EPHA10 contributes to tumor biology, ultimately facilitating the identification of new strategies for managing malignancies associated with this receptor.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US