Analytical Data
-
Gene name
Slc25a18
- Application
-
Alternative Names
Slc25a18;GC2;Mitochondrial glutamate carrier 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H1K4
-
Expression Region
1-315aa
-
AA Sequence
MTHQDLSITAKLINGGVAGLVGVTCVFPIDLAKTRLQNQHGKAMYKGMIDCLMKTARAEGFFGMYRGAAVNLTLVTPEKAIKLAANDFFRRLLMEDGMQRNLKMEMLAGCGAGMCQVVVTCPMEMLKIQLQDAGRLAVHHQGSASAPSTSRSYTTGSASTHRRPSATLIAWELLRTQGLAGLYRGLGATLLRDIPFSIIYFPLFANLNNLGFNELAGKASFAHSFVSGCVAGSIAAVAVTPLDVLKTRIQTLKKGLGEDMYSGITDCARKLWIQEGPSAFMKGAGCRALVIAPLFGIAQGVYFIGIGERILKCFD
-
Molecular Weight
33.8kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Slc25a18, a member of the mitochondrial carrier family, encodes a protein primarily involved in the transport of metabolites across the mitochondrial inner membrane. This protein is particularly significant for its role in the exchange of aspartate and glutamate, crucial intermediates in various metabolic pathways, including the urea cycle and amino acid metabolism. Understanding the function and regulation of Slc25a18 is essential for elucidating metabolic disorders that arise from mitochondrial dysfunction, which can lead to a range of pathologies, including neurodegenerative diseases and metabolic syndromes. Recent studies have highlighted the importance of Slc25a18 in cellular energy homeostasis and oxidative stress response, positioning it as a potential therapeutic target. To further investigate its biochemical properties and functional implications, recombinant Slc25a18 is produced for detailed structural and functional analyses. These studies involve expression in various systems, purification, and characterization to better understand its transport mechanisms and interactions within the mitochondrial environment. This research aims to provide insights into how disturbances in Slc25a18 function may contribute to disease and to identify potential drug targets for therapeutic interventions.











