Analytical Data
-
Gene name
MYT1
- Application
-
Alternative Names
MYT1；KIAA1106；Myelin transcription factor 1-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q01538
-
Expression Region
900-1101aa
-
AA Sequence
GLGHISGKYASHRSASGCPLAARRQKEGSLNGSSFSWKSLKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRATFAGKKGKLSGDEVLSPKFKTSDVLENDEEIKQLNQEIRDLNESNSEMEAAMVQLQSQISSMEKNLKNIEEENKLIEEQNEALFLELSGLSQALIQSLANIRLPHMEPICEQNFDAYVSTLTDMYSNQ
-
Molecular Weight
31.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MYT1 is a member of the myelin transcription factor family, primarily recognized for its role in the regulation of neuronal differentiation and myelination. Research has highlighted MYT1's critical function in embryonic development, particularly in neurogenesis, where it acts as a transcriptional repressor that modulates the expression of genes necessary for neuronal maturation. Recent studies have shown that MYT1 is not only involved in the development of the nervous system but also plays a role in various neurological disorders. Its ability to influence neuronal growth and maintenance has made it a focal point in understanding neurodegenerative diseases and developing potential therapeutic strategies. The investigation of MYT1 recombinant proteins has allowed researchers to delve deeper into its structural and functional properties, providing valuable insights into its mechanisms of action. Utilizing recombinant MYT1 proteins facilitates the exploration of protein interactions and post-translational modifications, contributing to the broader understanding of neuronal biology and potential interventions in neurodegenerative pathologies. Therefore, MYT1 represents a significant avenue for research into both fundamental neurobiology and clinical applications aimed at addressing disorders characterized by neuronal dysfunction.
