Cat: PA2000-9188

Recombinant Human MAP4K3 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MAP4K3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MAP4K3; RAB8IPL1Mitogen-activated protein kinase kinase kinase kinase 3; EC 2.7.11.1; Germinal center kinase-related protein kinase; GLK; MAPK/ERK kinase kinase kinase 3; MEK kinase kinase 3; MEKKK 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8IVH8

  • Expression Region

    1-380aa

  • AA Sequence

    MNPGFDLSRRNPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLE PGEDFAVVQQEIIMMKDCKHPNIVAYFGSYLRRDKLWICMEFCGGGSLQD IYHVTGPLSELQIAYVSRETLQGLYYLHSKGKMHRDIKGANILLTDNGHV KLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVERKGGYNQLCDLWAV GITAIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKMKWSNSFHHFV KMALTKNPKKRPTAEKLLQHPFVTQHLTRSLAIELLDKVNNPDHSTYHDF DDDDPEPLVAVPHRIHSTSRNVREEKTRSEITFGQVKFDPPLRKETEPHH ELPDSDGFLD SSEEIYYTARSNLDLQLEYG

  • Molecular Weight

    70 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MAP4K3, a member of the MAP4K family of serine/threonine kinases, has garnered considerable attention in recent years due to its potential roles in various cellular processes, including cell proliferation, migration, and apoptosis. Initial studies highlighted its involvement in the mitogen-activated protein kinase (MAPK) signaling pathway, a critical cascade that regulates cellular responses to extracellular stimuli. Dysregulation of MAP4K3 has been implicated in numerous pathological conditions, including cancer, where it may contribute to tumor progression and metastasis. Furthermore, emerging evidence suggests that MAP4K3 interacts with different signaling networks, influencing both the immune response and cellular stress responses. This complexity underscores the importance of MAP4K3 reconstituted proteins in elucidating its biological functions and pathways. Recent research efforts have focused on characterizing MAP4K3 through recombinant expression systems, allowing investigators to dissect its enzymatic activities, interaction partners, and post-translational modifications. Moreover, understanding the regulation and functional outcomes of MAP4K3 activity may reveal novel therapeutic targets for diseases associated with its dysregulation. As such, MAP4K3 stands out as a significant focus in cellular signaling research, promising to enhance our understanding of its roles in health and disease while paving the way for potential interventions in conditions linked with its altered function.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US