Cat: PA1000-2355

Recombinant Human PFN2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PFN2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PFN2;Profilin-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P35080

  • Expression Region

    1-140aa

  • AA Sequence

    MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDM IVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYN VAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF

  • Molecular Weight

    15 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PFN2, or profilin 2, is a multifunctional actin-binding protein that plays a critical role in cytoskeletal dynamics, cell motility, and various cellular processes. Its involvement in the regulation of actin polymerization has garnered attention, particularly in the context of neuronal development and synaptic function. PFN2 is highly expressed in the brain, suggesting a crucial role in neuronal processes such as growth cone dynamics and the formation of dendritic spines, which are essential for synaptic plasticity and learning. Aberrant expression or dysfunction of PFN2 has been implicated in several neurodegenerative diseases and cancers, highlighting its potential as a therapeutic target. Recent studies utilizing recombinant PFN2 protein have aimed to elucidate its structural and functional properties, providing insights into its mechanisms of action at the molecular level. By investigating the interactions of PFN2 with various actin-associated proteins and its role in signaling pathways, researchers hope to develop strategies for modulating its function in disease contexts. Furthermore, understanding PFN2’s role in cellular processes may open avenues for innovative therapeutic approaches in treating diseases characterized by dysregulated actin dynamics. Thus, the study of recombinant PFN2 protein continues to be a vital area of research within cellular and molecular biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US