Analytical Data
-
Gene name
yciM
- Application
-
Alternative Names
yciM；yciM；Lipopolysaccharide assembly Protein B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0AB58
-
Expression Region
17-389aa
-
AA Sequence
WYMGRRSAQQNKQDEANRLSRDYVAGVNFLLSNQQDKAVDLFLDMLKEDTGTVEAHLTLGNLFRSRGEVDRAIRIHQTLMESASLTYEQRLLAIQQLGRDYMAAGLYDRAEDMFNQLTDETDFRIGALQQLLQIYQATSEWQKAIDVAERLVKLGKDKQRVEIAHFYCELALQHMASDDLDRAMTLLKKGAAADKNSARVSIMMGRVFMAKGEYAKAVESLQRVISQDRELVSETLEMLQTCYQQLGKTAEWAEFLQRAVEENTGADAELMLADIIEARDGSEAAQVYITRQLQRHPTMRVFHKLMDYHLNEAEEGRAKESLMVLRDMVGEKVRSKPRYRCQKCGFTAYTLYWHCPSCRAWSTIKPIRGLDGL
-
Molecular Weight
46.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of YciM recombinant protein has garnered attention due to its potential implications in understanding bacterial physiology and pathogenesis. YciM is a protein found in various bacterial species, particularly in Escherichia coli, and is hypothesized to play a role in cellular processes such as stress response and cell envelope integrity. Recent research has indicated that YciM may be involved in bacterial survival under adverse environmental conditions, making it a candidate for further investigation as a target for antimicrobial strategies. By utilizing recombinant DNA technology, researchers can produce YciM in vitro, enabling detailed characterization of its structure, function, and interactions with other cellular components. Understanding the mechanism of action of YciM could illuminate novel pathways that are critical for bacterial adaptation and survival, especially in the context of antibiotic resistance. Moreover, insights gained from YciM research may contribute to the development of new therapeutic approaches to combat bacterial infections. Overall, exploring the properties and functions of YciM recombinant protein represents a promising avenue for advancing our knowledge of microbial biology and enhancing the arsenal against bacterial diseases.
