Cat: PA1000-2378

Recombinant Human PHB2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PHB2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PHB2;BAP;REA;Prohibitin-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q99623

  • Expression Region

    1-299aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMAQNLKDLAGRLPAGPRGMGTALKLLL GAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQY PIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLD YEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSL ILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQ AEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADN LVLNLQDESFTRGSDSLIKGKK

  • Molecular Weight

    36 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PHB2 (Prohibitin 2) is a well-characterized member of the prohibitin family of proteins, which are known to play crucial roles in cellular processes such as proliferation, apoptosis, and mitochondrial function. The interest in PHB2 has surged in recent years due to its involvement in various diseases, including cancer, neurodegenerative disorders, and metabolic syndromes. Structurally, PHB2 is found in both the mitochondria and the nucleus, where it interacts with various signaling pathways and transcription factors, influencing cell survival and growth. Research has shown that PHB2 can regulate the expression of genes related to energy metabolism and oxidative stress responses, highlighting its potential as a therapeutic target. Additionally, the ability to produce recombinant PHB2 proteins has facilitated the study of its functional mechanisms, interactions, and role in disease pathogenesis. These recombinant proteins are crucial for investigating PHB2's structure-function relationship and developing strategies to modulate its activity for therapeutic applications. Overall, understanding the biological significance of PHB2 through recombinant protein research is vital for elucidating its role in health and disease, potentially leading to novel interventions for related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US