Analytical Data
-
Gene name
METTL4
- Application
-
Alternative Names
METTL4；N(6)-adenine-specific methyltransferase METTL4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N3J2
-
Expression Region
1-472aa
-
AA Sequence
MSVVHQLSAGWLLDHLSFINKINYQLHQHHEPCCRKKEFTTSVHFESLQMDSVSSSGVCAAFIASDSSTKPENDDGGNYEMFTRKFVFRPELFDVTKPYITPAVHKECQQSNEKEDLMNGVKKEISISIIGKKRKRCVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPLFEKQDKGSKPITLPLDACSLSELCEMAKHLPSLNEMEHQTLQLVEEDTSVTEQDLFLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLLNYRKTFDVIVIDPPWQNKSVKRSNRYSYLSPLQIQQIPIPKLAAPNCLLVTWVTNRQKHLRFIKEELYPSWSVEVVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNVLPIPDHKLIVSVPCTLHSHKPPLAEVLKDYIKPDGEYLELFARNLQPGWTSWGNEVLKFQHVDYFIAVESGS
-
Molecular Weight
61.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
METTL4 (Methyltransferase-like 4) is a member of the methyltransferase family, known for its role in RNA methylation and regulation of gene expression. Recent studies have highlighted its involvement in various biological processes, including cell differentiation, proliferation, and response to stress. Its unique enzymatic activity catalyzes the transfer of methyl groups to specific RNA substrates, influencing mRNA stability and translation. Given the growing interest in RNA modifications and their impact on cellular functions, researchers have initiated investigations into the role of METTL4 in various diseases, including cancer and neurological disorders. Understanding its molecular mechanisms and protein interactions is crucial for uncovering potential therapeutic targets. The recombinant production of METTL4 provides valuable insights into its structural and functional properties, facilitating further exploration of its biological significance and potential applications in biomedicine. Through approaches such as X-ray crystallography and biophysical characterization, researchers aim to elucidate the precise mechanisms by which METTL4 exerts its effects on RNA metabolism and derive a deeper understanding of its contributions to health and disease.
This comprehensive exploration of METTL4 not only aims to clarify its biological roles but also seeks to establish a foundation for developing novel therapeutic strategies that target RNA methylation pathways, thereby expanding our understanding of the epitranscriptome in health and disease contexts.
