Cat: PA1000-2481

Recombinant Human PPM1D Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PPM1D

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PPM1D;WIP1;Protein phosphatase 1D

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O15297

  • Expression Region

    98-375aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMVAFFAVCDGHGGREAAQFAREHFWGFIKK QKGFTSSEPAKVCAAIRKGFLACHLAMWKKLAEWPKTMTGLPSTSGTTAS VVIIRGMKMYVAHVGDSGVVLGIQDDPKDDFVRAVEVTQDHKPELPKERE RIEGLGGSVMNKSGVNRVVWKRPRLTHNGPVRRSTVIDQIPFLAVARALG DLWSYDFFSGEFVVSPEPDTSVHTLDPQKHKYIILGSDGLWNMIPPQDAI SMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVICI

  • Molecular Weight

    33 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PPM1D, also known as Protein Phosphatase, Mg2+/Mn2+ dependent 1D, is a serine/threonine phosphatase that plays a crucial role in cellular processes, including cell cycle regulation, DNA damage response, and apoptosis. Recent studies have highlighted the significance of PPM1D in cancer biology, particularly its overexpression in various tumor types, which is often associated with poor prognosis. This phosphatase functions by dephosphorylating specific substrates involved in oncogenic signaling pathways, thus promoting tumor cell survival and resistance to therapy. Given its pivotal role in the tumor microenvironment, PPM1D has garnered interest as a potential biomarker for cancer diagnosis and prognosis, as well as a target for novel therapeutic strategies. Research into recombinant PPM1D proteins has been instrumental in elucidating its structure-function relationship, substrate specificity, and regulatory mechanisms. By producing recombinant PPM1D, scientists can conduct detailed functional assays and structural studies, paving the way for the development of inhibitors that could counteract its oncogenic activities. Consequently, the study of recombinant PPM1D remains a promising area of investigation, contributing to our understanding of tumor biology and the development of innovative cancer therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US