Analytical Data
-
Gene name
PRKAG1
- Application
-
Alternative Names
PRKAG1;5'-AMP-activated Protein kinase subunit gamma-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P54619
-
Expression Region
1-331aa
-
AA Sequence
METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRKAG1, a gene encoding the AMP-activated protein kinase (AMPK) regulatory subunit gamma 1, plays a crucial role in cellular energy homeostasis and metabolic regulation. Research into PRKAG1 has gained significant attention due to its involvement in energy-sensing pathways that affect various physiological processes, including glucose metabolism, lipid regulation, and mitochondrial function. Mutations in this gene have been linked to several metabolic disorders, such as familial hypertrophic cardiomyopathy and type 2 diabetes, highlighting its importance in human health. Understanding the functional mechanisms of PRKAG1 through recombinant protein studies can illuminate its role in AMPK activation and potential therapeutic targets for metabolic diseases. By producing and characterizing PRKAG1 recombinant protein, researchers aim to elucidate its interactions with other AMPK subunits and regulators, providing insights into its contribution to energy balance and adapting to metabolic stress. This research not only advances our knowledge of basic biological processes but also holds promise for the development of novel treatment strategies for metabolic disorders, emphasizing the significance of PRKAG1 in both fundamental and applied biomedical research.
