Analytical Data
-
Gene name
RUNX1
- Application
-
Alternative Names
RUNX1；AML1；CBFA2；Runt-related transcription factor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q01196
-
Expression Region
210-311aa
-
AA Sequence
RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQ YLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQF P
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RUNX1, a member of the RUNX transcription factor family, plays a critical role in hematopoiesis and is vital for the development of blood cells. It serves as a key regulator of various genes involved in cell differentiation, proliferation, and apoptosis. Mutations or dysregulation of RUNX1 have been implicated in several hematological malignancies, such as acute myeloid leukemia (AML) and myelodysplastic syndromes (MDS). The study of RUNX1 recombinant proteins is crucial for understanding its functional mechanisms, investigating how mutations impact its activity, and exploring potential therapeutic targets. Researchers utilize recombinant RUNX1 to analyze its interactions with other proteins, DNA binding properties, and post-translational modifications. Moreover, these studies can shed light on RUNX1's role in normal hematopoietic function and its disruption in cancer. By elucidating the structure-function relationships of RUNX1 and identifying interactors, scientists aim to develop novel strategies for intervention in diseases associated with RUNX1 aberrations. This research not only enhances our understanding of RUNX1 biology but also contributes to the broader field of cancer research, aiming to develop targeted therapies based on molecular profiles. Overall, RUNX1 recombinant protein studies are essential for unraveling the complexities of blood cell development and the pathology of hematological disorders.
