Cat: PA2000-903DB

Recombinant Human RUNX1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RUNX1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RUNX1;AML1;CBFA2;Runt-related transcription factor 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q01196

  • Expression Region

    210-311aa

  • AA Sequence

    RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQ YLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQF P

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RUNX1, a member of the RUNX transcription factor family, plays a critical role in hematopoiesis and is vital for the development of blood cells. It serves as a key regulator of various genes involved in cell differentiation, proliferation, and apoptosis. Mutations or dysregulation of RUNX1 have been implicated in several hematological malignancies, such as acute myeloid leukemia (AML) and myelodysplastic syndromes (MDS). The study of RUNX1 recombinant proteins is crucial for understanding its functional mechanisms, investigating how mutations impact its activity, and exploring potential therapeutic targets. Researchers utilize recombinant RUNX1 to analyze its interactions with other proteins, DNA binding properties, and post-translational modifications. Moreover, these studies can shed light on RUNX1's role in normal hematopoietic function and its disruption in cancer. By elucidating the structure-function relationships of RUNX1 and identifying interactors, scientists aim to develop novel strategies for intervention in diseases associated with RUNX1 aberrations. This research not only enhances our understanding of RUNX1 biology but also contributes to the broader field of cancer research, aiming to develop targeted therapies based on molecular profiles. Overall, RUNX1 recombinant protein studies are essential for unraveling the complexities of blood cell development and the pathology of hematological disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US