Analytical Data
-
Gene name
csgC
- Application
-
Alternative Names
csgC；agfC；orfC；Curli assembly Protein CsgC
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P52107
-
Expression Region
9-110aa
-
AA Sequence
ALSSQITFNTTQQGDVYTIIPEVTLTQSCLCRVQILSLREGSSGQSQTKQEKTLSLPANQPIALTKLSLNISPDDRVKIVVTVSDGQSLHLSQQWPPSSEKS
-
Molecular Weight
17.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
csgC is a gene associated with the production of curli fibers, which are a type of amyloid fiber involved in biofilm formation in various bacteria, particularly in Escherichia coli. These fibers play a crucial role in microbial adhesion and can significantly influence bacterial pathogenicity and environmental resilience. Recent studies have highlighted the importance of understanding the structure and function of csgC and its encoded proteins, as they are pivotal in the biogenesis of curli fibers. Research on csgC recombinant proteins has gained momentum due to their potential applications in biotechnology and medicine, including the development of biosensors, vaccines, and therapeutic agents. By studying the recombinant CsgC protein, researchers aim to elucidate the molecular mechanisms governing curli assembly and its interactions with host tissues. Moreover, insights into the role of csgC in biofilm development can provide valuable information for strategies to manage biofilm-related infections and improve industrial processes that rely on microbial aggregates. Understanding the recombinant CsgC protein's stability, folding, and interactions is essential for harnessing its properties for various applications, making it a focal point of ongoing microbiological and biochemical research.
