Analytical Data
-
Gene name
PSME1
- Application
-
Alternative Names
PSME1;IFI5111;Proteasome activator complex subunit 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q06323
-
Expression Region
1-249aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAMLRVQPEAQAKVDVFREDLCTKTENLLG SYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQ QEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNL VTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSE RGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDII LKNFEKLKKPRGETKGMIY
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PSME1, also known as Proteasome Activator Subunit 1, is a critical component of the 26S proteasome, which plays a vital role in protein degradation and cellular regulation. The proteasome is essential for maintaining cellular homeostasis by selectively degrading misfolded, damaged, or unneeded proteins, thus regulating various cellular processes including the cell cycle, signaling pathways, and stress responses. Research into PSME1 has gained momentum due to its involvement in key biological functions, including the modulation of immune responses and its potential role in cancer progression. Studies have shown that PSME1 can enhance the proteolytic activity of the proteasome, thereby influencing the turnover of oncogenic proteins and affecting tumorigenesis. Moreover, dysregulation of PSME1 has been implicated in several diseases, making it a potential therapeutic target. Understanding the structural and functional aspects of recombinant PSME1 can provide insights into its mechanisms of action and pave the way for the development of novel therapeutic strategies. As such, the production of recombinant PSME1 protein is crucial for elucidating its role in proteasome function and its broader implications in health and disease.
