Analytical Data
-
Gene name
PSMD9
- Application
-
Alternative Names
PSMD9;26S proteasome non-ATPase regulatory subunit 9
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00233
-
Expression Region
1-223aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMSDEEARQSGGSSQAGVVTVSDVQELM RRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVRTARH NIICLQNDHKAVMKQVEEALHQLHARDKEKQARDMAEAHKEAMSRKLGQS ESQGPPRAFAKVNSISPGSPASIAGLQVDDEIVEFGSVNTQNFQSLHNIG SVVQHSEGKPLNVTVIRRGEKHQLRLVPTRWAGKGLLGCNIIPLQR
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PSMD9 (Proteasome 26S subunit, non-ATPase 9) plays a pivotal role in the function of the 26S proteasome, a critical complex responsible for the degradation of ubiquitinated proteins in eukaryotic cells. This process is essential for maintaining cellular homeostasis, regulating various physiological processes, and removing damaged or misfolded proteins that could otherwise lead to neurodegenerative disorders and cancer. Research into PSMD9 has garnered significant attention due to its involvement in regulating cellular responses to stress, apoptosis, and immune responses. Recent studies have indicated that PSMD9 can influence the stability and activity of several substrates involved in key signaling pathways, further underscoring its potential as a therapeutic target. The recombinant production of PSMD9 allows researchers to investigate its structure, function, and role in proteasome activity, paving the way for potential interventions in diseases where proteasome dysfunction is implicated. Understanding PSMD9's functionality at the molecular level could lead to novel strategies for the treatment of various conditions, including malignancies, where the proteasome's role is often corrupted. Consequently, the study of PSMD9 not only enhances our comprehension of proteasomal mechanisms but also highlights its significance in developing new therapeutic approaches targeting proteasome-related pathways. As research continues, elucidating the intricate relationships between PSMD9 and cellular processes may offer insights into innovative treatments for diseases characterized by proteostasis imbalances.
