Cat: PA2000-5283

Recombinant Human CD16 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD16

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CD16;C4orf43;Translation machinery-associated Protein 16

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P08637

  • Expression Region

    17-208aa

  • AA Sequence

    GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESL ISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRW VFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKD SGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQHHHHHH

  • Molecular Weight

    23 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD16, also known as FcγRIII, is a critical receptor expressed on the surface of natural killer (NK) cells, macrophages, and some T cells, playing a pivotal role in the immune system's response to infections and tumors. Research on CD16 recombinant proteins has garnered significant interest due to their potential applications in immunotherapy and diagnostics. The understanding of CD16's structure and function has been enhanced through the development of recombinant technology, allowing for the production of CD16 proteins in a controlled environment. These engineered proteins can be utilized to study receptor-ligand interactions, elucidate signaling pathways, and enhance antibody-dependent cellular cytotoxicity (ADCC) mechanisms. Furthermore, recombinant CD16 proteins are being explored as therapeutic agents or tools in monoclonal antibody therapies, improving their efficacy in targeting cancer cells. The ability to manipulate CD16 expression and function offers opportunities to design novel immunotherapeutic strategies, potentially leading to improved outcomes in cancer treatment and infectious diseases. The ongoing research on CD16 recombinant proteins continues to provide insights into their therapeutic potential and mechanisms of action, contributing to the advancement of targeted immunotherapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US