Analytical Data
-
Gene name
MRPS18B
- Application
-
Alternative Names
Small ribosomal subunit protein mS40. 28S ribosomal protein S18-2. mitochondrial. MRP-S18-2. 28S ribosomal protein S18b. mitochondrial. MRP-S18-b. Mrps18-b. S18mt-b. Small ribosomal subunit protein bS18b
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y676
-
Expression Region
1-258 aa
-
AA Sequence
MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSSDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL
-
Molecular Weight
54.12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MRPS18B, a member of the mitochondrial ribosomal protein S18 family, plays a crucial role in mitochondrial biogenesis and protein synthesis, thus impacting crucial cellular processes such as energy production and apoptosis. Research indicates that MRPS18B is involved in mitochondrial translation, which is essential for the proper functioning of the mitochondria, the powerhouse of the cell. Dysregulation of MRPS18B has been linked to various pathological conditions, including neurodegenerative diseases and cancer, further underscoring its biological significance. Recent studies have focused on the recombinant expression of MRPS18B to explore its functional mechanisms and interactions within the mitochondrial ribosome, enabling the investigation of its role in mitochondrial disorders. The development of MRPS18B recombinant protein provides valuable insights into its structure-function relationship and offers potential for therapeutic applications, particularly in targeting mitochondrial dysfunction. Understanding the precise mechanisms by which MRPS18B operates could lead to novel strategies in the treatment of diseases associated with mitochondrial impairment, making it a promising target for future research in cellular bioenergetics and metabolic regulation.
