Cat: PA2000-9502

Recombinant Human MS4A7 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MS4A7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MS4A7; 4SPAN2; CD20L4; CFFM4; Membrane-spanning 4-domains subfamily A member 7; CD20 antigen-like 4; CD20/FC-epsilon-RI-beta family member 4; Four-span transmembrane protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9GZW8

  • Expression Region

    1-240 aa

  • AA Sequence

    MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLIS SLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTS NAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVS LTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI

  • Molecular Weight

    26.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MS4A7, a member of the MS4A (membrane-spanning 4-domain subfamily A) gene family, has garnered increasing attention in recent years due to its association with various biological processes and diseases. Initially implicated in immune system regulation, MS4A7 is expressed in several immune cells, suggesting a potential role in inflammatory responses. Research has also linked MS4A7 to certain neurodegenerative diseases, particularly Alzheimer's disease, where its expression levels may influence amyloid-beta metabolism. The understanding of MS4A7's function is further complicated by its polymorphisms, which have been associated with altered susceptibility to complex diseases, particularly in diverse populations. The recombinant expression of MS4A7 protein in various model systems is crucial for elucidating its structure-function relationships, facilitating the identification of its interaction partners, and exploring its potential as a therapeutic target. Advances in recombinant protein technology have enabled the production of MS4A7 in sufficient quantities for detailed biochemical and biophysical analysis, enhancing our understanding of its role in cellular signaling pathways and immune responses. This research has significant implications for both basic biology and translational medicine, particularly in developing strategies for modulating MS4A7 activity in disease contexts, thereby potentially therapeutic intervention in conditions where MS4A7 is implicated. As the body of knowledge around MS4A7 expands, it may reveal novel insights into disease mechanisms and underscore the importance of membrane proteins in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US