Cat: PA1000-2603

Recombinant Human QTRT1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    QTRT1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    QTRT2;QTRTD1;Queuine tRNA-ribosyltransferase accessory subunit 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BXR0

  • Expression Region

    1-403aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSEFMAGAATQASLESAPRIMRLVAECSR SRARAGELWLPHGTVATPVFMPVGTQATMKGITTEQLDALGCRICLGNTY HLGLRPGPELIQKANGLHGFMNWPHNLLTDSGGFQMVSLVSLSEVTEEGV RFRSPYDGNETLLSPEKSVQIQNALGSDIIMQLDDVVSSTVTGPRVEEAM YRSIRWLDRCIAAHQRPDKQNLFAIIQGGLDADLRATCLEEMTKRDVPGF AIGGLSGGESKSQFWRMVALSTSRLPKDKPRYLMGVGYATDLVVCVALGC DMFDCVFPTRTARFGSALVPTGNLQLRKKVFEKDFGPIDPECTCPTCQKH SRAFLHALLHSDNTAALHHLTVHNIAYQLQLMSAVRTSIVEKRFPDFVRD FMGAMYGDPTLCPTWATDALASVGITLG

  • Molecular Weight

    47 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

QTRT1, or Quattro Protein 1, is a recombinant protein that has garnered attention in the field of molecular biology and biotechnology due to its potential applications in therapeutic and industrial settings. As a member of a novel protein family, QTRT1 is believed to play a crucial role in various cellular processes, including signal transduction, protein folding, and stress response mechanisms. The study of QTRT1 is particularly significant because of its implications in understanding disease mechanisms, such as those related to neurodegenerative disorders and cancer. Researchers are focusing on its structural and functional characterization to unveil its biological roles and interactions within cellular systems. The advantages of using recombinant proteins like QTRT1 include the ability to produce them in large quantities and the potential for modification to enhance their functionality. Efforts to elucidate the mechanisms by which QTRT1 operates are paving the way for innovative strategies in drug design and therapeutic interventions. Additionally, the protein's characteristics make it a promising candidate for use in biocatalysis and as a biosensor. Overall, ongoing research into QTRT1 is contributing to a deeper understanding of protein functions and fostering advancements in biotechnology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US