Analytical Data
-
Gene name
MTRF1
- Application
-
Alternative Names
mitochondrial; MRF-1; MRF1 ; MtRF-1; MTRF1; Peptide chain release factor 1; Peptide chain release factor 1; mitochondrial; RF1M_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75570
-
Expression Region
1-151 aa
-
AA Sequence
MNRHLCVWLFRHPSLNGYLQCHIQLHSHQFRQIHLDTRLQVFRQNRNCILHLLSKNWSRRYCHQDTKMLWKHKALQKYMENLSKEYQTLEQCLQHIPVNEENRRSLNRRHAELAPLAAIYQEIQETEQAIEELESMCKKTESCSVAQAGMQ
-
Molecular Weight
44.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MTRF1, or mitochondrial translational release factor 1, is a key protein involved in the termination of protein synthesis within the mitochondrial environment. Its study has gained significant attention due to the critical role mitochondria play in cellular metabolism, energy production, and apoptosis. Disruptions in mitochondrial function are implicated in a variety of human diseases, including neurodegenerative disorders, metabolic syndromes, and certain forms of cancer. Research into MTRF1 is particularly important as it represents a potential therapeutic target for these conditions. By understanding the mechanisms underlying MTRF1 function and its interactions with mitochondrial ribosomes and other factors, scientists aim to elucidate the broader implications of mitochondrial protein synthesis in health and disease. Moreover, variations in the MTRF1 gene and corresponding protein levels have been associated with disease susceptibility, making it a subject of interest in genetic and clinical studies. Investigating MTRF1 not only enhances our comprehension of mitochondrial biology but also opens avenues for novel interventions that can restore normal mitochondrial function and counteract disease progression. Overall, the research on MTRF1 may pave the way for innovative strategies in the treatment of various mitochondrial-related disorders, highlighting the importance of this protein in both basic and applied biomedical sciences.
