Analytical Data
-
Gene name
CG alpha
-
简介
The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CGA-CGB3 Heterodimer Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived CGA-CGB3 Heterodimer protein, expressed by HEK293 , with C-6*His labeled tag. CGA-CGB3 Heterodimer Protein, Human (HEK293, His), has molecular weight of 22 & 30-35 kDa, respectively.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized LSHR protein at 2 μg/mL(100 μL/well) can bind CGA-CGB3. The ED50 for this effect is 1.163 µg/mL . Measured by its binding ability in a functional ELISA. Immobilized LSHR protein at 2 μg/mL(100 μL/well) can bind CGA-CGB3. The ED50 for this effect is 1163ng/mL.
-
Alternative Names
Glycoprotein hormones alpha chain; CG-alpha; FSH-alpha; CGA
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01215 (A25-S116)&P0DN86
-
Expression Region
P01215 (A25-S116)&P0DN86 (S21-Q165)
-
AA Sequence
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS&SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
-
Protein Length
Partial
-
Molecular Weight
22&30-35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CG alpha recombinant protein, derived from the calcitonin gene (CALCA), has garnered significant interest in biomedical research due to its potential applications in various therapeutic areas. Calcitonin, originally identified as a hormone involved in calcium homeostasis, has been shown to possess neuroprotective and analgesic properties, making CG alpha a promising candidate for treating pain disorders and neurodegenerative conditions. Recombinant technology allows for the production of this protein in a controlled manner, facilitating studies on its structure-function relationships and biological activities. Additionally, the use of CG alpha in drug development is appealing because it can interact with a variety of receptors implicated in pain pathways. Research has also explored its potential role in modulating bone metabolism and cardiovascular health. As scientists delve deeper into the mechanisms of CG alpha, understanding its signaling pathways could lead to novel therapeutic strategies, particularly in conditions where traditional treatments have fallen short. Furthermore, advancements in recombinant protein production technology enhance the scalability and efficiency of CG alpha synthesis, paving the way for clinical applications. Overall, the ongoing research into CG alpha recombinant protein is poised to reveal important insights that could inform innovative treatments in medicine.











