Analytical Data
-
Gene name
N4BP2
- Application
-
Alternative Names
N4BP2; B3BP; KIAA1413; NEDD4-binding protein 2; N4BP2; EC 3.-.-.-; BCL-3-binding protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86UW6
-
Expression Region
1671-1770 aa
-
AA Sequence
HLAAIEIFEKVNASLLPQNVLDLHGLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAVIKYLISHSFRFSEIKPGCLKVMLK
-
Molecular Weight
36.74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
N4BP2 is a relatively newly identified protein that has garnered attention in the field of cellular and molecular biology due to its potential implications in various biological processes and diseases. This protein belongs to the NBP family and is implicated in regulating intracellular signaling pathways, which are crucial for maintaining cellular homeostasis and responding to external stimuli. Research has indicated that N4BP2 plays a significant role in processes such as apoptosis, cell proliferation, and immune responses. Dysregulation or mutations in this protein have been linked to several pathologies, including cancer and autoimmune diseases, making it a promising target for therapeutic interventions. The recombinant study of N4BP2 involves producing this protein in a controlled laboratory setting, allowing for detailed investigation of its structure, function, and interactions with other biomolecules. By expressing N4BP2 in systems such as E. coli or mammalian cells, researchers can analyze its biochemical properties and explore how alterations in its activity may contribute to disease mechanisms. Understanding N4BP2's roles could lead to novel strategies for diagnosis and treatment, enhancing our overall comprehension of its functions in health and disease.
