Analytical Data
-
Gene name
SBDS
- Application
-
Alternative Names
SBDS;Ribosome maturation Protein SBDS
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y3A5
-
Expression Region
1-250aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSIFTPTNQIRLTNVAVVRMKRAGKRFEIA CYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQ TEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTV ILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPV NEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKG KGSLEVLNLKDVEEGDEKFE
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of SBDS (Shwachman-Diamond syndrome protein) and its role as a recombinant protein has gained significant attention due to its association with Shwachman-Diamond syndrome (SDS), a rare genetic disorder characterized by exocrine pancreatic insufficiency, hematological abnormalities, and increased cancer predisposition. The SBDS gene, located on chromosome 7, encodes a protein involved in ribosome biogenesis and cellular stress response. Mutations in the SBDS gene disrupt these critical processes, leading to the clinical manifestations of SDS. Research on SBDS recombinant protein offers insights into the molecular mechanisms underlying the disease, facilitating the development of potential therapeutic strategies. Recombinant SBDS can be utilized in various experiments to elucidate its structure, function, and interactions with other cellular components. By understanding how SBDS operates at a cellular level, researchers aim to uncover pathways that could be targeted for treatment, improving patient outcomes for those affected by SDS. Furthermore, studying SBDS as a recombinant protein also allows for the exploration of potential roles in other diseases, given its involvement in ribosome assembly and cellular homeostasis. Ultimately, the insights gained from SBDS research hold promise not only for advancing our knowledge of Shwachman-Diamond syndrome but also for enhancing our understanding of fundamental biological processes relevant to a broader spectrum of diseases.
