Cat: PA1000-2841

Recombinant Human SBDS Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SBDS

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SBDS;Ribosome maturation Protein SBDS

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y3A5

  • Expression Region

    1-250aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMSIFTPTNQIRLTNVAVVRMKRAGKRFEIA CYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQ TEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTV ILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPV NEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKG KGSLEVLNLKDVEEGDEKFE

  • Molecular Weight

    31 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of SBDS (Shwachman-Diamond syndrome protein) and its role as a recombinant protein has gained significant attention due to its association with Shwachman-Diamond syndrome (SDS), a rare genetic disorder characterized by exocrine pancreatic insufficiency, hematological abnormalities, and increased cancer predisposition. The SBDS gene, located on chromosome 7, encodes a protein involved in ribosome biogenesis and cellular stress response. Mutations in the SBDS gene disrupt these critical processes, leading to the clinical manifestations of SDS. Research on SBDS recombinant protein offers insights into the molecular mechanisms underlying the disease, facilitating the development of potential therapeutic strategies. Recombinant SBDS can be utilized in various experiments to elucidate its structure, function, and interactions with other cellular components. By understanding how SBDS operates at a cellular level, researchers aim to uncover pathways that could be targeted for treatment, improving patient outcomes for those affected by SDS. Furthermore, studying SBDS as a recombinant protein also allows for the exploration of potential roles in other diseases, given its involvement in ribosome assembly and cellular homeostasis. Ultimately, the insights gained from SBDS research hold promise not only for advancing our knowledge of Shwachman-Diamond syndrome but also for enhancing our understanding of fundamental biological processes relevant to a broader spectrum of diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US