Analytical Data
-
Gene name
OR14A16
- Application
-
Alternative Names
OR14A16; OR5AT1; Olfactory receptor 14A16; Olfactory receptor 5AT1; Olfactory receptor OR1-45
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NHC5
-
Expression Region
1-309 aa
-
AA Sequence
MANLTIVTEFILMGFSTNKNMCILHSILFLLIYLCALMGNVLIIMITTLDHHLHTPVYFF LKNLSFLDLCLISVTAPKSIANSLIHNNSISFLGCVSQVFLLLSSASAELLLLTVMSFDR YTAICHPLHYDVIMDRSTCVQRATVSWLYGGLIAVMHTAGTFSLSYCGSNMVHQFFCDIP QLLAISCSENLIREIALILINVVLDFCCFIVIIITYVHVFSTVKKIPSTEGQSKAYSICL PHLLVVLFLSTGFIAYLKPASESPSILDAVISVFYTMLPPTFNPIIYSLRNKAIKVALGM LIKGKLTKK
-
Molecular Weight
34.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR14A16 is a member of the olfactory receptor gene family, which plays a critical role in the detection of volatile organic compounds and the subsequent perception of smell. The study of OR14A16 is particularly significant due to its involvement in the olfactory signaling pathways and its potential implications in understanding olfactory-related disorders. The interest in this receptor has been fueled by its emerging role in the modulation of various physiological processes, including emotion and behavior, which are closely linked to olfactory inputs. Moreover, advancements in recombinant protein technologies have allowed for the characterization of OR14A16 at the molecular level, paving the way for exploring its ligand-binding properties and functional mechanisms. Such research not only contributes to the fundamental understanding of olfactory biology but also offers potential applications in fields such as fragrance development, flavor science, and even therapeutic interventions for olfactory dysfunction. Investigating the expression, structure, and function of OR14A16 could provide insights into the complexities of sensory perception and enhance our knowledge of how we interact with and respond to our environment through smell.
