Cat: PA2000-9901

Recombinant Human OR2B6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OR2B6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OR2B6; OR2B1; OR2B1P; OR2B5; OR2B6P; Olfactory receptor 2B6; Hs6M1-32; Olfactory receptor 2B1; Olfactory receptor 2B5; Olfactory receptor 5-40; OR5-40; Olfactory receptor 6-31; OR6-31; Olfactory receptor OR6-4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P58173

  • Expression Region

    1-313 aa

  • AA Sequence

    MNWVNDSIIQEFILLGFSDRPWLEFPLLVVFLISYTVTIFGNLTIILVSRLDTKLHTPMY FFLTNLSLLDLCYTTCTVPQMLVNLCSIRKVISYRGCVAQLFIFLALGATEYLLLAVMSF DRFVAICRPLHYSVIMHQRLCLQLAAASWVTGFSNSVWLSTLTLQLPLCDPYVIDHFLCE VPALLKLSCVETTANEAELFLVSELFHLIPLTLILISYAFIVRAVLRIQSAEGRQKAFGT CGSHLIVVSLFYSTAVSVYLQPPSPSSKDQGKMVSLFYGIIAPMLNPLIYTLRNKEVKEG FKRLVARVFLIKK

  • Molecular Weight

    35.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of the OR2B6 recombinant protein has gained significant attention due to its role as a member of the olfactory receptor (OR) family, which is crucial for the sense of smell in mammals. Olfactory receptors are G protein-coupled receptors (GPCRs) that play a vital role in detecting odorant molecules and initiating neuronal signaling pathways. The OR2B6 receptor is known to be activated by specific odorants, linking the perception of smell to various physiological responses and behaviors. Understanding the structure and function of OR2B6 through recombinant protein expression provides insights into its ligand-binding mechanisms and signal transduction pathways. Additionally, studying OR2B6 can enhance our knowledge of the genetic and molecular basis of olfactory function and dysfunction. Given the potential implications for olfactory-related disorders, such as anosmia or hyposmia, which can arise from various genetic or environmental factors, research on OR2B6 may contribute to the development of therapeutic strategies. The generation of recombinant OR2B6 proteins in heterologous systems allows researchers to investigate its biophysical properties, pharmacology, and interaction with different ligands in a controlled environment, paving the way for future studies on its physiological and clinical relevance.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US