Analytical Data
-
Gene name
IGFBP-1
-
简介
IGFBP-1 Protein, a member of the insulin-like growth factor-binding protein (IGFBP) family, extends IGFs' half-life and modulates their growth-promoting effects on cell culture, inhibiting or stimulating these responses. Crucially, it alters the interaction between IGFs and their cell surface receptors and promotes cell migration. Notably versatile, IGFBP-1 shows equal binding affinity for both IGF1 and IGF2, underscoring its diverse role in modulating the biological activities of insulin-like growth factors. IGFBP-1 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived IGFBP-1 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. When Recombinant Rhesus IGFBP1 Protein is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant human IGF1. The ED50 for this effect is 81.21 ng/mL. Measured by its binding ability in a functional ELISA. When Recombinant Rhesus IGFBP1 Protein is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant human IGF1. The ED50 for this effect is 81.21 ng/mL.
-
Alternative Names
Insulin-like growth factor-binding protein 1; IGFBP1
-
Species
Rhesus Macaque
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
XP_001085935
-
Expression Region
A48-N281
-
AA Sequence
APWQCAPCSAEKLALCPPVPASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQDSDASASNAEAAGSPESPESTEITEEELLDNFHLMAPSEEDHSTLWDAIGTYDSSKAVHVTNVKKWKEPCRIELYRVVESLTKAQETSGEDISKFYLPNCNKNGFYHSRQCETSLAGEERLCWCVYPWNGKRIPGSPEIRGDPNCQTYFNVQN
-
Protein Length
Partial
-
Molecular Weight
30-35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Insulin-like growth factor binding protein-1 (IGFBP-1) is a key regulatory protein that modulates the effects of insulin-like growth factors (IGFs) in various physiological processes, including cell growth, development, and metabolism. Research has shown that IGFBP-1 plays a significant role in the fetal and postnatal growth stages, influencing developmental outcomes and metabolic health. Altered levels of IGFBP-1 have been associated with several pathological conditions, such as diabetes, obesity, and certain cancers, making it a potential biomarker for these diseases. The recombinant production of IGFBP-1 has gained attention in recent years due to its potential applications in therapeutic and diagnostic settings. By utilizing recombinant DNA technology, researchers can produce IGFBP-1 in sufficient quantities for in vitro and in vivo studies, allowing for a deeper understanding of its biological functions and interactions with IGFs. This research supports the exploration of IGFBP-1 as a therapeutic target, as well as its utility in evaluating disease states related to growth and metabolism. Moreover, the study of IGFBP-1 can provide insights into the mechanisms of growth regulation and hormone action, which are vital for developing novel treatment strategies and improving patient outcomes in metabolic and growth-related disorders.











