Cat: PA2000-9957

Recombinant Human OR51G1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OR51G1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OR51G1; OR51G3P; Olfactory receptor 51G1; Olfactory receptor 51G3; Olfactory receptor OR11-29

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8NGK1

  • Expression Region

    1-321 aa

  • AA Sequence

    MTILLNSSLQRATFFLTGFQGLEGLHGWISIPFCFIYLTVILGNLTILHVICTDATLHGP MYYFLGMLAVTDLGLCLSTLPTVLGIFWFDTREIGIPACFTQLFFIHTLSSMESSVLLSM SIDRYVAVCNPLHDSTVLTPACIVKMGLSSVLRSALLILPLPFLLKRFQYCHSHVLAHAY CLHLEIMKLACSSIIVNHIYGLFVVACTVGVDSLLIFLSYALILRTVLSIASHQERLRAL NTCVSHICAVLLFYIPMIGLSLVHRFGEHLPRVVHLFMSYVYLLVPPLMNPIIYSIKTKQ IRQRIIKKFQFIKSLRCFWKD

  • Molecular Weight

    36.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

OR51G1, a member of the olfactory receptor family, has emerged as a subject of interest in various biomedical research fields due to its potential roles beyond traditional olfaction. Originally identified in the human genome, OR51G1 is mainly expressed in the nasal epithelium, but studies have indicated its expression in non-olfactory tissues, suggesting it could have diverse biological functions. Recent investigations have linked OR51G1 to processes such as cancer progression and the modulation of immune responses, highlighting its potential involvement in pathogen recognition and cellular signaling pathways. The protein has also gained attention for its role in mediating responses to specific ligands, influencing cell migration and proliferation. Recombinant OR51G1 protein has become a key tool in elucidating these pathways, enabling researchers to explore its functional implications in greater detail. Understanding OR51G1's structure and interactions will provide insights into its mechanistic roles in health and disease, paving the way for novel therapeutic approaches targeting this receptor. As research progresses, OR51G1 may reveal new dimensions of olfactory receptors outside their conventional sensory functions, further expanding our understanding of their significance in human biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US