Analytical Data
-
Gene name
OR9G4
- Application
-
Alternative Names
OR9G4; Olfactory receptor 9G4; Olfactory receptor OR11-216
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGQ1
-
Expression Region
1-327 aa
-
AA Sequence
MIFPSHDSQAFTSVDMEVGNCTILTEFILLGFSADSQWQPILFGVFLMLYLITLSGNMTL VILIRTDSHLHTPMYFFIGNLSFLDFWYTSVYTPKILASCVSEDKRISLAGCGAQLFFSC VVAYTECYLLAAMAYDRHAAICNPLLYSGTMSTALCTGLVAGSYIGGFLNAIAHTANTFR LHFCGKNIIDHFFCDAPPLVKMSCTNTRVYEKVLLGVVGFTVLSSILAILISYVNILLAI LRIHSASGRHKAFSTCASHLISVMLFYGSLLFMYSRPSSTYSLERDKVAALFYTVINPLL NPLIYSLRNKDIKEAFRKATQTIQPQT
-
Molecular Weight
36.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR9G4 is a member of the olfactory receptor family, which plays a critical role in the detection of odorants in the olfactory system. As a G protein-coupled receptor (GPCR), it is involved in the transduction of chemical signals into neural responses. Recent studies have highlighted the significance of OR9G4 in various biological processes, including its potential involvement in human health and disease. Research has shown that specific olfactory receptors, including OR9G4, can contribute to the modulation of immune responses and may influence neurobehavioral conditions. The expression patterns of OR9G4 in various tissues further underscore its functional relevance beyond the nose. As a result, the recombinant protein of OR9G4 has become a subject of interest for scientists aiming to understand its structural and functional properties. Investigating the synthesis and functionality of OR9G4 could provide insights into its role in olfactory signaling and its therapeutic potential in addressing olfactory disorders or other related health issues. This research may also open avenues for exploring the integration of olfactory receptors into biomarker development and drug discovery, thereby enhancing our overall understanding of GPCR biology within the context of olfaction and its broader implications in human physiology.
