Analytical Data
-
Gene name
TIMP2
- Application
-
Alternative Names
TIMP2；MetalloProteinase inhibitor 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P16035
-
Expression Region
27-220aa
-
AA Sequence
CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
-
Molecular Weight
25.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TIMP2 (Tissue Inhibitor of Metalloproteinases 2) is a crucial regulator of extracellular matrix remodeling, playing a significant role in tissue homeostasis and repair. Initially recognized for its function in inhibiting matrix metalloproteinases (MMPs), TIMP2 has garnered attention due to its involvement in various physiological and pathological processes, including fibrosis, cancer metastasis, and inflammation. The recombinant production of TIMP2 protein facilitates detailed studies of its structural and functional properties, allowing researchers to explore its mechanisms of action at the molecular level. Moreover, the ability to produce TIMP2 in a recombinant form enhances its potential for therapeutic applications, as it can be used in preclinical models to investigate its effects on tissue repair and regeneration, as well as its impact on tumor progression. Recent advancements in protein expression technologies have enabled the generation of high-purity TIMP2, paving the way for innovative studies into its role as a biomarker or therapeutic agent. As such, TIMP2 continues to be a focal point in biomedical research, with ongoing investigations aimed at elucidating its diverse biological functions and therapeutic potential.
