Analytical Data
-
Gene name
ORMDL2
- Application
-
Alternative Names
ORMDL2; HSPC160; MSTP095; ORM1-like protein 2; Adoplin-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q53FV1
-
Expression Region
1-153 aa
-
AA Sequence
MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHMVLLSIPFFSIPVVWTLTNVIHNLAT YVFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYD AAHFLINTASLLSVLLPKLPQFHGVRVFGINKY
-
Molecular Weight
17.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ORMDL2, or ORM-like protein 2, is a member of the family of proteins implicated in various cellular processes, including inflammation and immune responses. Recent studies have implicated ORMDL2 in the regulation of asthma and other airway inflammatory diseases, particularly due to its role in modulating the activity of sphingolipid metabolism and influencing airway hyperresponsiveness. Its overexpression has been associated with increased susceptibility to asthma, highlighting the significance of this protein in pathophysiological conditions. Researchers have focused on recombinant ORMDL2 proteins to better understand their structure and function, as well as to explore potential therapeutic targets. The recombinant protein can be used in functional assays to elucidate its biological activity and interactions with other cellular components, which may reveal insights into its involvement in signaling pathways related to inflammation and immune regulation. As such, ORMDL2 represents a promising candidate for further investigation in the context of respiratory diseases, and the development of therapies targeting this protein could potentially lead to novel interventions for asthma and related conditions. Furthermore, the exploration of ORMDL2's mechanisms may contribute to the broader understanding of immune responses and the development of more effective treatments for inflammatory diseases.
