Cat: PA2000-5540

Recombinant Human APOBEC3B Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    APOBEC3B

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    APOBEC3BDNA dC->dU-editing enzyme APOBEC-3B; A3B; EC 3.5.4.38; Phorbolin-1-related Protein; Phorbolin-2/3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UH17

  • Expression Region

    1-251aa

  • AA Sequence

    MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGQVY FKPQYHAEMCFLSWFCGNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISA ARLYYYWERDYRRALCRLSQAGARVTIMDYEEFAYCWENFVYNEGQQFMPWYKFDENYAF LHRTLKEILRLRIFSVAFTAAMRSCASWTWFLLCSWTRPRSTGSLGSSPGAPASPGAVPG KCVRSFRRTHT

  • Molecular Weight

    45.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

APOBEC3B is a member of the APOBEC (Apolipoprotein B mRNA Editing Enzyme Catalytic Polypeptide) family, which is known for its role in regulating RNA and DNA editing. Its primary function involves deaminating cytosine residues in single-stranded DNA, leading to mutations that can hinder viral replication and contribute to genomic diversity. A critical aspect of APOBEC3B research is its implication in cancer biology; overexpression of this enzyme has been linked to the accumulation of mutations in tumor DNA, thereby influencing tumorigenesis and cancer progression. Understanding the structural and functional characteristics of APOBEC3B, including its protein-protein interactions and regulatory mechanisms, is vital for elucidating its role in both antiviral defense and oncogenesis. Additionally, studies have indicated that this enzyme's activity can be modulated by various cellular factors, which positions it as a potential target for therapeutic interventions aimed at controlling viral infections or cancer development. The ongoing exploration of APOBEC3B, including the design and testing of recombinant proteins, aims to enhance our understanding of its diverse functions and pave the way for novel strategies in molecular medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US