Cat: IPD-X14068

Recombinant Mouse Adiponectin/Acrp30 Protein

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Adiponectin/Acrp30

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    1.The ED50 is <5>2.0 × 102 units/mg. 2. Measured by its ability to induce TIMP-1 secretion by RAW264.7 mouse macrophages cell. The ED50 for this effect is 1.841 μg/mL, Corresponding to a specific activity is 543.183 U/mg. Measured by its ability to induce TIMP-1 secretion by RAW264.7 mouse macrophages cell. The ED50 for this effect is 1.841 μg/mL, Corresponding to a specific activity is 543.183 U/mg.

  • Alternative Names

    rMuAdiponectin; Acrp-30; GBP-28; Apm-1; Acrp 30; Acrp30

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    Tag Free

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    Q60994

  • Expression Region

    V21-N247

  • AA Sequence

    VTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    26 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Adiponectin, also known as Acrp30, is a peptide hormone secreted by adipocytes that plays a crucial role in metabolic processes, including insulin sensitivity, glucose regulation, and fatty acid oxidation. Its anti-inflammatory and insulin-sensitizing properties have drawn significant interest in the context of obesity, type 2 diabetes, and cardiovascular diseases. Research has shown that lower levels of adiponectin are associated with obesity-related complications, making it a potential biomarker for metabolic disorders. Recombinant adiponectin/Acrp30 protein has been developed to explore its therapeutic potential in treating metabolic syndromes. Studies investigating the functional aspects of this protein have highlighted its ability to enhance the metabolic profile, improve insulin sensitivity, and reduce inflammation in various animal models. Furthermore, recombinant adiponectin holds promise for clinical applications, including the treatment of insulin-resistant states and obesity-related conditions. As researchers continue to elucidate the mechanisms behind adiponectin's actions, the development and optimization of recombinant forms of this protein may pave the way for novel therapeutic strategies aimed at combating metabolic diseases and improving overall metabolic health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US