Analytical Data
-
Gene name
ATIC
- Application
-
Alternative Names
AICAR transformylase; AICARFT; AICARFT/IMPCHASE; ATIC
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P31939
-
Expression Region
1-592aa
-
AA Sequence
MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
-
Molecular Weight
91 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The ATIC (5-aminoimidazole-4-carboxamide ribonucleotide transformylase/inosine monophosphate cyclohydrolase) protein plays a crucial role in purine biosynthesis, specifically in the incorporation of formyl groups into the nucleotide precursors. The interest in ATIC has surged due to its involvement in various cellular processes and its potential as a therapeutic target in diseases such as cancer and autoimmune disorders. By catalyzing two separate reactions within the de novo purine synthesis pathway, ATIC contributes to the production of essential nucleotides necessary for DNA and RNA synthesis. Studies on the structural and functional aspects of ATIC have unveiled its unique enzymatic mechanisms, which are vital for understanding how disruptions in purine metabolism can lead to pathological conditions. Furthermore, the exploration of ATIC's role in cellular stress responses, alongside its interactions with other metabolic pathways, has highlighted its importance beyond nucleotide synthesis alone. As researchers continue to uncover the intricacies of ATIC's biological functions, its potential as a drug target becomes increasingly significant, particularly in developing inhibitors that could selectively disrupt purine metabolism in rapidly proliferating cells. Thus, studying ATIC not only offers insights into fundamental biochemical processes but also paves the way for innovative therapeutic strategies in treating diseases related to nucleotide imbalance.
