Cat: PA1000-3434

Recombinant Human UTP23 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    UTP23

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    UTP23;C8orf53;rRNA-processing Protein UTP23 homolog

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BRU9

  • Expression Region

    1-249aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMKITRQKHAKKHLGFFRNNFGVREPYQ ILLDGTFCQAALRGRIQLREQLPRYLMGETQLCTTRCVLKELETLGKDLY GAKLIAQKCQVRNCPHFKNAVSGSECLLSMVEEGNPHHYFVATQDQNLSV KVKKKPGVPLMFIIQNTMVLDKPSPKTIAFVKAVESGQLVSVHEKESIKH LKEEQGLVKNTEQSRRKKRKKISGPNPLSCLKKKKKAPDTQSSASEKKRK RKRIRNRSNPKVLSEKQNAEGE

  • Molecular Weight

    31 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

UTP23, a protein involved in ribosomal RNA processing, has garnered attention due to its critical role in cellular functions. Recent studies have highlighted the importance of UTP23 in the maturation of pre-rRNA, a vital step in ribosome biogenesis. Dysfunction in this process can lead to various diseases, including cancer and genetic disorders related to ribosomopathies. Moreover, UTP23 operates within the larger U3 snoRNP complex, which is essential for early stages of ribosome assembly. Understanding UTP23’s structure and function not only sheds light on fundamental biological processes but also opens avenues for potential therapeutic interventions targeting disorders related to ribosome malfunctions. Advancements in techniques such as cryo-electron microscopy and biochemical assays are enhancing our comprehension of UTP23's interactions and regulatory mechanisms. As research progresses, elucidating the role of UTP23 could provide significant insights into the intricate network of ribosome assembly and its implications for human health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US