Cat: IPD-X12724

Recombinant Human IGFBP-6 Protein(HEK293), C-His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IGFBP-6

  • 简介

    IGFBP-6 protein is an important IGFBP member that regulates insulin-like growth factor (IGF) by changing its interaction with cell surface receptors, thereby affecting IGF-induced growth responses. In addition to regulating IGF signaling, IGFBP-6 also activates the MAPK pathway and induces cell migration. IGFBP-6 Protein, Human (HEK293, His) is the recombinant human-derived IGFBP-6 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    1. Measured by its ability to bind human IGF1 in functional ELISA. 2. Measured by its ability to bind human IGF2 in functional ELISA. 3. Measured by its ability to inhibit the biological activity of IGFII on MCF7 human breast adenocarcinoma cells (Karey, K.P. et al. (1988) Cancer Research 48:4083.). The ED50 for this effect is typically 1-5 μg/mL in the presence of 14 ng/mL human IGFII.

  • Alternative Names

    Insulin-like growth factor-binding protein 6; IBP-6; IGFBP-6; IBP6

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P24592

  • Expression Region

    R28-G240

  • AA Sequence

    MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    30-38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Insulin-like growth factor binding protein 6 (IGFBP-6) is a member of the IGFBP family that plays a critical role in regulating the actions of insulin-like growth factors (IGFs) within biological systems. Unlike other IGFBPs, IGFBP-6 has been shown to possess unique properties, including a strong affinity for IGF-II and the ability to modulate IGF signaling pathways in various tissues. Research has highlighted its involvement in numerous physiological processes, including cell growth, differentiation, and apoptosis, as well as its potential role in cancer progression and metabolic disorders. Given its significant biological functions, there is growing interest in the production and characterization of recombinant IGFBP-6 for both experimental and therapeutic applications. This protein's potential as a biomarker or therapeutic target in diseases such as cancer provides a compelling reason for further investigation. By studying the recombinant form of IGFBP-6, scientists aim to better understand its mechanisms of action, develop assays for its quantification, and explore its utility in clinical settings, potentially leading to novel interventions in IGF-related diseases. Consequently, the research on recombinant IGFBP-6 not only enriches our fundamental understanding of IGF signaling but also opens avenues for new therapeutic strategies in various pathologies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US