Analytical Data
-
Gene name
TMPRSS5
- Application
-
Alternative Names
TMPRSS5；Transmembrane protease serine 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H3S3
-
Expression Region
1-457aa
-
AA Sequence
MSLMLDDQPPMEAQYAEEGPGPGIFRAEPGDQQHPISQAVCWRSMRRGCAVLGALGLLAGAGVGSWLLVLYLCPAASQPISGTLQDEEITLSCSEASAEEALLPALPKTVSFRINSEDFLLEAQVRDQPRWLLVCHEGWSPALGLQICWSLGHLRLTHHKGVNLTDIKLNSSQEFAQLSPRLGGFLEEAWQPRNNCTSGQVVSLRCSECGARPLASRIVGGQSVAPGRWPWQASVALGFRHTCGGSVLAPRWVVTAAHCMHSFRLARLSSWRVHAGLVSHSAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALNFSDTVGAVCLPAKEQHFPKGSRCWVSGWGHTHPSHTYSSDMLQDTVVPLFSTQLCNSSCVYSGALTPRMLCAGYLDGRADACQGDSGGPLVCPDGDTWRLVGVVSWGRGCAEPNHPGVYAKVAEFLDWIHDTAQDSLL
-
Molecular Weight
49.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMPRSS5 (Transmembrane Protease, Serine 5) is a member of the type II transmembrane serine proteases, which play crucial roles in various biological processes, including cellular signaling, tissue remodeling, and immunity. Recent studies have highlighted TMPRSS5's potential involvement in viral infections, particularly in the entry mechanism of certain viruses. It has been suggested that TMPRSS5 may activate viral glycoproteins, facilitating the entry of enveloped viruses into host cells. This has garnered significant research interest, especially in the context of emerging viral pathogens, where understanding the viral entry mechanisms can provide insights for therapeutic interventions. Moreover, TMPRSS5 expression has been linked to specific cancers, thus presenting it as a potential biomarker for tumor progression. The recombination and characterization of the TMPRSS5 protein allow researchers to investigate its enzymatic activity, substrate specificity, and interaction with viral components. By studying TMPRSS5 and its role in both viral pathogenesis and cancer biology, scientists aim to develop novel antiviral strategies and therapeutic agents. Therefore, the research on recombinant TMPRSS5 not only enriches our understanding of fundamental biological processes but also opens up avenues for medical applications in infectious diseases and oncology.
