Cat: PA1000-3580

Recombinant Human SENP2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SENP2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SENP2;KIAA1331;Sentrin-specific protease 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9HC62

  • Expression Region

    360-589aa

  • AA Sequence

    RRTDDLLELTEDMEKEISNALGHGPQDEILSSAFKLRITRGDIQTLKNYH WLNDEVINFYMNLLVERNKKQGYPALHVFSTFFYPKLKSGGYQAVKRWTK GVNLFEQEIILVPIHRKVHWSLVVIDLRKKCLKYLDSMGQKGHRICEILL QYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFTCKYADYI SRDKPITFTQHQMPLFRKKMVWEILHQQLL

  • Molecular Weight

    28 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SENP2, or SUMO-specific protease 2, is an essential enzyme that plays a critical role in the post-translational modification process known as SUMOylation. This process involves the attachment of Small Ubiquitin-like Modifier (SUMO) proteins to target proteins, thereby influencing their function, localization, and stability. Dysregulation of SUMOylation has been implicated in various pathological conditions, including cancer, neurodegenerative diseases, and developmental disorders. Given its pivotal function in cellular processes, such as gene expression, stress response, and cell cycle regulation, SENP2 has emerged as a significant research focus. The study of SENP2, particularly its recombinant protein, provides insights into its enzymatic activity and regulatory mechanisms. Understanding how SENP2 modulates SUMOylation can reveal potential therapeutic targets for diseases associated with SUMO pathway dysregulation. Recent advances in recombinant DNA technology and protein purification methods have facilitated the production of highly pure SENP2 proteins, enabling researchers to perform detailed biochemical and structural analyses. Investigating SENP2's interactions with SUMO conjugates and other cellular proteins can uncover its role within the SUMO signaling network and its implications for cell biology. Consequently, research on SENP2 recombinant protein stands at the forefront of understanding SUMOylation dynamics and its impact on health and disease, paving the way for innovative therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US