Cat: PA1000-3610

Recombinant Human IL25 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL25

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL25;IL17E;Interleukin-25

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H293

  • Expression Region

    33-177aa

  • AA Sequence

    MYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGP LNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSE LLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG

  • Molecular Weight

    17 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IL-25, also known as interleukin-17E, is a cytokine that plays a crucial role in immune responses, particularly in the context of allergic inflammation and asthma. It is predominantly secreted by Th2 cells and contributes to the activation of various immune cells, leading to the production of IgE and the recruitment of eosinophils, which are key players in allergic reactions. Research on recombinant IL-25 has gained momentum due to its potential therapeutic applications in treating asthma and other allergic diseases. Scientists have been investigating the signaling pathways mediated by IL-25 and its interactions with other cytokines in the Th2 immune response. Understanding the molecular mechanisms through which IL-25 exerts its effects could pave the way for the development of new strategies to modulate immune responses in allergic conditions. Additionally, recombinant IL-25 has been used in preclinical models to study its role in disease progression and to explore novel interventions aimed at attenuating Th2-mediated inflammation. Overall, the study of recombinant IL-25 holds promise for advancing our understanding of allergic diseases and contributing to the development of targeted therapies to enhance patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US