Cat: PAX2000-10349

Recombinant Human PITRM1 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PITRM1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    hMP1; hPreP; KIAA1104; Metalloprotease 1; MGC138192; MGC141929 ; mitochondrial; MP1; Pitrilysin metallopeptidase 1; Pitrilysin metalloproteinase 1; PITRM 1; PITRM1; PreP; PreP peptidasome; PREP_HUMAN; Presequence protease; Presequence protease mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q5JRX3

  • Expression Region

    1-534 aa

  • AA Sequence

    MRPDDKYHEKQAQVEATKLKQKVEALSPGDRQQIYEKGLELRSQQSKPQDASCLPALKVSDIEPTIPVTELDVVLTAGDIPVQYCAQPTNGMVYFRAFSSLNTLPEELRPYVPLFCSVLTKLGCGLLDYREQAQQIELKTGGMSASPHVLPDDSHMDTYEQGVLFSSLCLDRNLPDMMQLWSEIFNNPCFEEEEHFKVLVKMTAQELANGIPDSGHLYASIRAGRTLTPAGDLQETFSGMDQVRLMKRIAEMTDIKPILRKLPRIKKHLLNGDNMRCSVNATPQQMPQTEKAVEDFLRSIGRSKKERRPVRPHTVEKPVPSSSGGDAHVPHGSQVIRKLVMEPTFKPWQMKTHFLMPFPVNYVGECIRTVPYTDPDHASLKILARLMTAKFLHTEIREKGGAYGGGAKLSHNGIFTLYSYRDPNTIETLQSFGKAVDWAKSGKFTQQDIDEAKLSVFSTVDAPVAPSDKGMDHFLYGLSDEMKQAHREQLFAVSHDKLLAVSDRYLGTGKSTHGLAILGPENPKIAKDPSWIIR

  • Molecular Weight

    84.48 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PITRM1, also known as Mitochondrial Intermediate Peptidase 1, plays a crucial role in mitochondrial protein maturation by processing precursor proteins imported into the mitochondria. Research into PITRM1 has gained traction due to its involvement in various cellular processes, including mitochondrial function, apoptosis, and cellular stress responses. Dysregulation of PITRM1 expression or function has been linked to several diseases, including neurodegenerative disorders and cancer, highlighting its potential as a therapeutic target. The study of recombinant PITRM1 proteins is essential for understanding its biochemical properties, substrate specificity, and role in mitochondrial biology. By producing and characterizing recombinant PITRM1, researchers aim to elucidate the mechanisms underlying its function, identify potential inhibitors or modulators, and explore its interactions with other mitochondrial proteins. Moreover, insights gained from this research could lead to novel strategies for targeting PITRM1 in disease contexts, thus contributing to the development of new therapeutic approaches. Overall, the exploration of PITRM1 through recombinant protein studies underscores its significance in maintaining mitochondrial integrity and cellular homeostasis.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US