Analytical Data
-
Gene name
PKHD1L1
- Application
-
Alternative Names
PKHD1L1; Fibrocystin-L; Polycystic kidney and hepatic disease 1-like protein 1; PKHD1-like protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86WI1
-
Expression Region
4105-4186 aa
-
AA Sequence
KATDSDGNCVSVGITALTLRAILKDSNNNQVNGLSGNTTIPFSSCWANYTDLTPLRTGKNYKIEFILDNVVGVESRTFSLLA
-
Molecular Weight
34.76 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PKHD1L1 (Polycystic Kidney and Hepatic Disease 1-Like 1) is a gene that plays a crucial role in the development of renal and hepatic structures, particularly in the context of polycystic kidney disease (PKD). This gene is known for its involvement in renal tubular development and function, and mutations in PKHD1L1 have been associated with various cystic kidney diseases and liver pathologies. Research on PKHD1L1 recombinant protein has gained traction due to its potential implications in understanding the mechanisms underlying PKD and related disorders. Scientists have sought to express PKHD1L1 as a recombinant protein to study its structure and function in detail, enabling them to explore the pathways of renal and hepatic cell development and the molecular basis of diseases stemming from PKHD1L1 dysregulation. The recombinant protein can serve as a valuable tool for elucidating the role of PKHD1L1 in cellular processes, paving the way for advancements in therapeutic approaches for PKD and providing insights into novel biomarkers for early diagnosis. This line of investigation is crucial for developing targeted therapies that may ameliorate the progression of kidney and liver diseases linked to this gene, highlighting the significance of PKHD1L1 in both basic research and clinical contexts. As our understanding of PKHD1L1 improves through recombinant protein studies, it may lead to innovative biomedical applications and enhance our capacity to manage hereditary renal and hepatic conditions effectively.
