Cat: PA2000-1710

Recombinant Human Plaa Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Plaa

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Plaa;PLAP;Phospholipase A-2-activating Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P27612

  • Expression Region

    495-584aa

  • AA Sequence

    TGAGRYMPGSAGMDTTMTGVDPFTGNSAYRSAASKTVNIYFPKKEALTFDQANPTQILGKLKELNGTAPEEKKLTEDDLVLLEKILSLIC

  • Molecular Weight

    13.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Plaa, or Phospholipase A2-activated protein, is a pivotal component in various biological processes, including inflammation, cell signaling, and membrane dynamics. This protein has garnered significant attention in recent years due to its role in modulating cellular responses to external stimuli. Research into Plaa's structure and function has revealed its involvement in the mechanisms of disease, particularly in cancer and neurodegenerative disorders, where its dysregulation can lead to pathological outcomes. The study of Plaa encompasses a multidisciplinary approach, combining biochemistry, molecular biology, and biophysics to elucidate its interactions with phospholipids and other cellular components. As scientists seek to understand the precise mechanisms through which Plaa exerts its effects, the potential for therapeutic applications becomes increasingly apparent. By targeting Plaa's pathways or modulating its activity, researchers aim to develop novel strategies for intervention in diseases characterized by inflammation and cell dysfunction. Thus, the ongoing exploration of Plaa not only contributes to the fundamental understanding of cellular biology but also holds promise for innovative treatments in the realm of medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US