Cat: PA1000-3895

Recombinant Human MINPP1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MINPP1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MINPP1;MIPP;Multiple inositol polyphosphate phosphatase 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UNW1

  • Expression Region

    31-487aa

  • AA Sequence

    SLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTP VQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAA LADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLI TSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFD HCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADL IQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYT INSRSSCTLFQDIFQHLDKAVEQKQRSQPISSPVILQFGHAETLLPLLSL MGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLYHCENAKTPKE QFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARA NSTSDEL

  • Molecular Weight

    54 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MINPP1, or Mannose-6-Phosphate Isomerase, is a crucial enzyme involved in the regulation of mannose-6-phosphate, a significant precursor for glycoprotein synthesis and lysosomal enzyme targeting. It plays a vital role in maintaining cellular homeostasis and has been implicated in various pathological conditions, including cancer and neurodegenerative diseases. Research into MINPP1 recombinant protein has gained considerable attention due to its potential therapeutic applications. The ability to produce MINPP1 in a recombinant form allows for detailed studies of its structure and function, providing insights into its enzymatic activity and potential as a biomarker or drug target. Additionally, understanding the regulatory mechanisms that govern MINPP1 expression and activity can offer valuable information for developing strategies to manipulate its function in disease contexts. Recent advances in molecular biology techniques, such as CRISPR and advanced purification methods, have facilitated the production and characterization of MINPP1, paving the way for exploring its role in cellular processes and its potential in biomedicine. As research progresses, the elucidation of MINPP1's mechanisms may lead to novel interventions for diseases associated with glycosylation imbalances and other metabolic disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US