Analytical Data
-
Gene name
ALKAL2
- Application
-
Alternative Names
ALKAL2；FAM150B；ALK and LTK ligand 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UX46
-
Expression Region
25-152aa
-
AA Sequence
GAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQLLGRDCALGRAEAAGLGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPVCMEDKQ
-
Molecular Weight
21.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ALKAL2, a member of the alkaline phosphatase (ALP) family, has garnered significant attention in recent years due to its potential roles in various biological processes, including bone mineralization, cellular signaling, and metabolic regulation. Its expression is notably upregulated in certain pathological conditions, suggesting a link between ALKAL2 and disease states such as cancer and metabolic disorders. Researchers have been investigating recombinant ALKAL2 proteins to elucidate their structural properties, enzymatic activity, and biological functions. The production of recombinant ALKAL2 provides a valuable tool for studying its interactions with substrates and inhibitors, which could lead to the development of novel therapeutic agents. Furthermore, understanding the regulation of ALKAL2 expression and activity is crucial for exploiting its potential in clinical applications. Overall, the investigation of ALKAL2 and its recombinant proteins is pivotal in advancing our knowledge of alkaline phosphatases and their impact on human health, emphasizing the need for continued research in this promising area.
