Analytical Data
-
Gene name
CDNF
- Application
-
Alternative Names
CDNF；ARMETL1；Cerebral dopamine neurotrophic factor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q49AH0
-
Expression Region
25-187aa
-
AA Sequence
QGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDT KGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQIC ELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQEL APKYAATHPKTEL
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDNF (Cerebral Dopamine Neurotrophic Factor) is a relatively novel neurotrophic factor that has garnered significant attention in the field of neuroscience and neurodegenerative diseases research. Originally identified for its protective effects on dopaminergic neurons, CDNF has been shown to play a crucial role in promoting neuronal survival, supporting neuronal function, and facilitating the repair of damaged neural tissues. Its unique ability to cross the blood-brain barrier and its potential therapeutic benefits make it an appealing candidate for treating conditions like Parkinson's disease, Alzheimer's disease, and other neurodegenerative disorders. Research has demonstrated that CDNF can not only enhance the survival of dopaminergic neurons but also restore neurotransmitter balance and improve motor functions in animal models of neurodegenerative diseases. Scientists are exploring the structural and functional characteristics of CDNF, including its interactions with cellular receptors and downstream signaling pathways, to better understand its mechanisms of action. Additionally, the development of recombinant CDNF proteins for clinical applications is an active area of investigation. These studies aim to evaluate the efficacy of CDNF in promoting neuroprotection and neuroregeneration, with the ultimate goal of advancing toward potential therapeutic interventions for patients suffering from debilitating neurological conditions. The ongoing research into CDNF illustrates the broader endeavor to unlock new avenues for treatment in the fight against neurodegeneration, highlighting the importance of understanding neurotrophic factors in developing effective therapies.
