Analytical Data
-
Gene name
IFNAR2
- Application
-
Alternative Names
IFNAR2；IFNABR；Interferon alpha/beta receptor 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P48551
-
Expression Region
27-243aa
-
AA Sequence
ISYDSPDYTDESCTFKISLRNFRSILSWELKNHSIVPTHYTLLYTIMSKP EDLKVVKNCANTTRSFCDLTDEWRSTHEAYVTVLEGFSGNTTLFSCSHNF WLAIDMSFEPPEFEIVGFTNHINVMVKFPSIVEEELQFDLSLVIEEQSEG IVKKHKPEIKGNMSGNFTYIIDKLIPNTNYCVSVYLEHSDEQAVIKSPLK CTLLPPGQESESAESAKVDHHHHHH
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interferon-alpha receptor 2 (IFNAR2) is a crucial protein that plays a significant role in the immune response mediated by type I interferons, which are vital for combating viral infections and modulating the immune system. It is one of the two subunits of the type I interferon receptor, with the other being IFNAR1. The binding of type I interferon to this receptor initiates a cascade of signaling events that lead to the expression of various antiviral proteins and immune-modulatory factors, thereby enhancing the host's defense mechanisms. Research into IFNAR2 has gained prominence due to its implications in viral pathogenesis, autoimmune diseases, and potential therapeutic applications. Understanding the structural and functional dynamics of IFNAR2 can provide insights into its role in these processes. Moreover, recombinant IFNAR2 proteins are valuable tools for investigating receptor interactions, signaling pathways, and the development of antiviral drugs. Studying the mechanisms by which IFNAR2 mediates its effects can lead to advancements in vaccine development and targeted therapies for diseases related to dysregulated interferon responses. Additionally, the exploration of IFNAR2 interactions with other cellular proteins may uncover novel therapeutic targets for enhancing antiviral immune responses or mitigating autoimmune disorders. Overall, the study of IFNAR2 and its recombinant forms represents a promising avenue for research in immunology and virology, with the potential to inform future clinical strategies.
