Cat: IPD-X12766

Recombinant Mouse Angiopoietin-1 Protein(HEK293), N-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Angiopoietin-1

  • 简介

    Angiopoietin-1 (ANGPT1) is a secreted glycoprotein that belongs to the angiopoietin family. It actively regulates blood vessel formation and stabilization, playing a pivotal role in vascular development. ANGPT1 also influences skeletal myoblasts and orchestrates the vascular response to tissue injury. Its broad expression in various tissues highlights its significance in diverse physiological contexts. Angiopoietin-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Angiopoietin-1 protein, expressed by HEK293 , with N-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by the ability of the immobilized protein to support the adhesion of HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 223.9 ng/mL, corresponding to a specific activity is 4.466×10^3 units/mg. Measured by the ability of the immobilized protein to support the adhesion of HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 223.9 ng/mL, corresponding to a specific activity is 4.466×103 units/mg.

  • Alternative Names

    AGP1; AGPT; ANG-1; Angiopoietin-1; ANGPT1

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    N-6*His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    NP_033770.2

  • Expression Region

    R277-F498

  • AA Sequence

    REEEKPFRDCADVYQAGFNKSGIYTIYFNNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF

  • Protein Length

    Partial

  • Molecular Weight

    29 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Angiopoietin-1 (Ang-1) is a crucial protein that plays a significant role in angiogenesis, the process of new blood vessel formation, which is essential for maintaining vascular stability and regulating inflammation. It is part of the Angiopoietin/Tie signaling pathway, where Ang-1 binds to its receptor Tie-2, facilitating vascular maturation and stabilization. Research has highlighted Ang-1's potential in therapeutic applications, particularly in conditions such as cardiovascular diseases, cancer, and wound healing, where angiogenesis is often disrupted. Recombinant Angiopoietin-1 proteins are being studied for their ability to enhance endothelial cell survival, proliferation, and migration, ultimately promoting healthy blood vessel formation. Additionally, Ang-1's anti-inflammatory properties are of interest, as they could mitigate tissue injury and promote repair mechanisms. As scientists explore the molecular mechanisms underlying Ang-1's functions, recombinant protein technology offers opportunities for developing novel treatments that harness the protective effects of Ang-1, making it a promising candidate in regenerative medicine and vascular therapy.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US