Analytical Data
-
Gene name
PIK3IP1
- Application
-
Alternative Names
PIK3IP1；HGFL；Phosphoinositide-3-kinase-interacting Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96FE7
-
Expression Region
22-168aa
-
AA Sequence
SGGCFWDNGHLYREDQTSPAPGLRCLNWLDAQSGLASAPVSGAGNHSYCR NPDEDPRGPWCYVSGEAGVPEKRPCEDLRCPETTSQALPAFTTEIQEASE GPGADEVQVFAPANALPARSEAAAVQPVIGISQRVRMNSKEKKDLGTVDH HHHHH
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PIK3IP1, a protein encoded by the PIK3IP1 gene, plays a crucial role in the regulation of the phosphatidylinositol 3-kinase (PI3K) signaling pathway, which is pivotal in cellular processes such as growth, proliferation, and survival. This protein acts primarily as a negative regulator of the PI3K pathway, thereby influencing various cellular functions and maintaining homeostasis. Dysregulation of PI3K signaling is implicated in numerous diseases, including cancer, metabolic disorders, and autoimmune diseases. Given the importance of this pathway, researchers are keen to explore the functional mechanisms of PIK3IP1, its structure, and potential interactions with other signaling molecules. Recombinant PIK3IP1 protein has become an essential tool for studying its biological functions and elucidating its interactions within the PI3K pathway. By producing this protein in a controlled laboratory setting, scientists can investigate its role in cellular signaling, determine its effects on cell behavior, and assess its potential as a therapeutic target. Furthermore, understanding PIK3IP1’s structure may provide insights into designing specific inhibitors or modulators that can alter PI3K activity in pathological conditions. As such, the study of recombinant PIK3IP1 not only enhances our comprehension of cellular signaling networks but also paves the way for developing novel therapeutic approaches to manage diseases related to PI3K dysregulation.
