Cat: PA1000-4319

Recombinant Human TNFRSF1B Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TNFRSF1B

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TNFRSF1B;TRAP3;TNF receptor-associated factor 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-terminal His Tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P20333

  • Expression Region

    31-227aa

  • AA Sequence

    PYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYT QLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCA PLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPG NASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHT

  • Molecular Weight

    24.7kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Tumor necrosis factor receptor superfamily member 1B (TNFRSF1B), also known as TNF receptor II (TNFR2), is a key player in the immune system, mediating various cellular functions, including proliferation, apoptosis, and differentiation. Research into TNFRSF1B has gained significant attention due to its role in modulating inflammatory responses and its potential implications in autoimmune diseases, cancer, and chronic inflammatory conditions. Unlike its counterpart TNFRSF1A, which primarily signals apoptosis, TNFRSF1B is associated with cell survival and immune regulation. The ability to produce recombinant TNFRSF1B facilitates the study of its biological properties, interactions with ligands such as TNF-alpha, and its signaling pathways. This is crucial for developing therapeutic strategies aimed at manipulating TNFRSF1B signaling to enhance immune responses against tumors or to inhibit excessive inflammation in autoimmune disorders. Furthermore, understanding TNFRSF1B regulation and its downstream effects may lead to novel drug targets that can effectively modulate the immune system's activity, promising advancements in precision medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US