Cat: PA1000-4449

Recombinant Human SERPINB1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SERPINB1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SERPINB1;ELANH2;MNEI;PI2;Leukocyte elastase inhibitor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P30740

  • Expression Region

    1-379aa

  • AA Sequence

    MEQLSSANTRFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNT AAQLSKTFHFNTVEEVHSRFQSLNADINKRGASYILKLANRLYGEKTYNF LPEFLVSTQKTYGADLASVDFQHASEDARKTINQWVKGQTEGKIPELLAS GMVDNMTKLVLVNAIYFKGNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQ KKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQL TLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSS KADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGIATFCMLMPEE NFTADHPFLFFIRHNSSGSILFLGRFSSP

  • Molecular Weight

    67 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SERPINB1, also known asserpin peptidase inhibitor, clade B member 1, is a member of the serpin superfamily, which plays a critical role in regulating various biological processes, including cell proliferation, apoptosis, and inflammation. This protein is primarily expressed in epithelial cells and is known to inhibit serine proteases, thereby modulating proteolytic activity within tissues. Research on SERPINB1 has gained traction due to its potential implications in various diseases, including cancer, where it is thought to influence tumor progression and metastasis by modulating the extracellular environment and immune responses. Additionally, SERPINB1 has been implicated in chronic inflammatory conditions, where its expression levels can affect tissue homeostasis and repair mechanisms. The recombinant expression of SERPINB1 allows for detailed study of its structure-function relationships, interactions with other biomolecules, and potential therapeutic applications, such as in the development of novel drugs targeting protease-related pathways. Understanding SERPINB1's biological roles and mechanisms is essential for uncovering its potential as a biomarker for disease and a target for intervention in various pathological states. Thus, research focusing on recombinant SERPINB1 holds promise for advancing our knowledge of its multifunctional roles in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US