Analytical Data
-
Gene name
CDKN2D
- Application
-
Alternative Names
CDKN2D；Cyclin-dependent kinase 4 inhibitor D
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55273
-
Expression Region
1-166aa
-
AA Sequence
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
-
Molecular Weight
44.7kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDKN2D, also known as p19INK4d, is a member of the INK4 family of cyclin-dependent kinase inhibitors (CDKIs) that plays a crucial role in regulating the cell cycle. As a tumor suppressor, CDKN2D is involved in the inhibition of CDK4 and CDK6, thereby preventing the phosphorylation of retinoblastoma (Rb) protein and controlling the progression of the cell cycle from the G1 phase to the S phase. Studies have shown that alterations in the CDKN2D gene are linked to various malignancies, particularly in hematological cancers and certain solid tumors, positioning it as a potential biomarker for cancer prognosis and therapy. The investigation of recombinant CDKN2D protein has gained traction in recent years, aiming to elucidate its function, regulatory mechanisms, and its role in cancer biology. By producing CDKN2D in a recombinant form, researchers can analyze its interactions with other cell cycle regulators and assess its potential as a therapeutic target. Such studies contribute to a deeper understanding of tumorigenesis and may lead to the development of novel strategies for cancer treatment that leverage the tumor-suppressive properties of CDKN2D. Additionally, the recombinant protein could serve as a valuable tool for high-throughput screening of small molecules that may activate or mimic its function, thereby offering new avenues for therapeutic intervention in tumors with compromised CDKN2D activity. Ultimately, comprehensive research into CDKN2D and its recombinant protein has the potential to significantly advance our understanding of cancer biology and provide new insights for developing targeted therapies.
